PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00003651001
Common NameGSBRNA2T00003651001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 406aa    MW: 46095 Da    PI: 10.2867
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00003651001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.61.8e-32243298258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          ep++VNaKQy++I++RR++Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  GSBRNA2T00003651001 243 EPVFVNAKQYHAIMRRREQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 298
                          9****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.1E-38240301IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.704241301IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.0E-27243298IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-23244266IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860246266IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.2E-23275298IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
KWQWWCSWRW WFPSKAKRDR NRHRQRIKRR ITPVQYDTHP LIHLVSFKIS KRQQQSTLFC  60
KDRETCKTNR RFIQLLKRYS SCEDSLLGVM HQMNKKDSTL PYLNTSISWG GVDARPEHMQ  120
TTKQISFQDL DSPSSQSTCQ SYTEVASSGD DNPSIQISFS TKSGSEETQH KGFATHPNSA  180
SMTGVPSIHF APTQANFSFH YADPQIGGLL AATYLPHAPT CHPQMVGMVL GRVPLPVEIT  240
ETEPVFVNAK QYHAIMRRRE QRAKLEAQNK LIKARKPYLH ESRHVHALKR PRGSGGRFLN  300
TKQLLQESEQ TAAKEQERDK LVQQGSKKAN MSRLDAHMLQ HNKDRGSTTS GSDITSVSDG  360
ADIFGHTEFQ LSGFPTTQTN RAMLVHGQSN DMHGGGDLHH FSIHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19243303363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133091e-158seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591675.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
SwissprotQ93ZH20.0NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078JS780.0A0A078JS78_BRANA; BnaCnng68450D protein (Fragment)
STRINGBra003867.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.10.0nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]